A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10266
Swiss-prot Accession number	Q9W7F0 (Sequence in FASTA format)
Description	Somatostatin-1 precursor (Somatostatin I) (PSS1) [Contains:Somatostatin-27; Somatostatin-14].
Source organism	Protopterus annectens (African lungfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Dipnoi; Lepidosireniformes; Protopteridae; Protopterus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatostatin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Somatostatin inhibits the release of somatotropin
Protein Length	115 Amino acids
Molecular weight	12600
References	1  PubMed abstract 10398054 2   ; Trabucchi M., Tostivint H., Lihrmann I., Jegou S., Vallarino M.,Vaudry H.; "Molecular cloning of the cDNAs and distribution of the mRNAs encodingtwo somatostatin precursors in the African lungfish Protopterusannectens."; J. Comp. Neurol. 410:643-652(1999).
Domain Name	Somatostatin
Hormone Name	Somatostatin-27
Mature Hormone Sequence	SANSSPLAARERKAGCKNFFWKTFTSC
Position of mature hormone in Pre-Hormone protein	27 Residues from position (89-115)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10267
Swiss-prot Accession number	Q9W7F0 (Sequence in FASTA format)
Description	Somatostatin-1 precursor (Somatostatin I) (PSS1) [Contains:Somatostatin-27; Somatostatin-14].
Source organism	Protopterus annectens (African lungfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Dipnoi; Lepidosireniformes; Protopteridae; Protopterus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatostatin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Somatostatin inhibits the release of somatotropin
Protein Length	115 Amino acids
Molecular weight	12600
References	1  PubMed abstract 10398054 2   ; Trabucchi M., Tostivint H., Lihrmann I., Jegou S., Vallarino M.,Vaudry H.; "Molecular cloning of the cDNAs and distribution of the mRNAs encodingtwo somatostatin precursors in the African lungfish Protopterusannectens."; J. Comp. Neurol. 410:643-652(1999).
Domain Name	Somatostatin
Hormone Name	Somatostatin-14
Mature Hormone Sequence	AGCKNFFWKTFTSC
Position of mature hormone in Pre-Hormone protein	14 Residues from position (102-115)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10271
Swiss-prot Accession number	Q9W7E9 (Sequence in FASTA format)
Description	Somatostatin-2 precursor (Somatostatin II) (PSS2) [Contains: [Pro17]-somatostatin-29; [Pro2]-somatostatin-14].
Source organism	Protopterus annectens (African lungfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Dipnoi; Lepidosireniformes; Protopteridae; Protopterus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatostatin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Somatostatin inhibits the release of somatotropin
Protein Length	109 Amino acids
Molecular weight	12422
References	1  PubMed abstract 10398054 2   ; Trabucchi M., Tostivint H., Lihrmann I., Jegou S., Vallarino M.,Vaudry H.; "Molecular cloning of the cDNAs and distribution of the mRNAs encodingtwo somatostatin precursors in the African lungfish Protopterusannectens."; J. Comp. Neurol. 410:643-652(1999).
Domain Name	Somatostatin
Hormone Name	[Pro17]-somatostatin-29
Mature Hormone Sequence	AAYNALPQLPQRDRKAPCKNFFWKTFTSC
Position of mature hormone in Pre-Hormone protein	29 Residues from position (81-109)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	10272
Swiss-prot Accession number	Q9W7E9 (Sequence in FASTA format)
Description	Somatostatin-2 precursor (Somatostatin II) (PSS2) [Contains: [Pro17]-somatostatin-29; [Pro2]-somatostatin-14].
Source organism	Protopterus annectens (African lungfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Dipnoi; Lepidosireniformes; Protopteridae; Protopterus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatostatin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Somatostatin inhibits the release of somatotropin
Protein Length	109 Amino acids
Molecular weight	12422
References	1  PubMed abstract 10398054 2   ; Trabucchi M., Tostivint H., Lihrmann I., Jegou S., Vallarino M.,Vaudry H.; "Molecular cloning of the cDNAs and distribution of the mRNAs encodingtwo somatostatin precursors in the African lungfish Protopterusannectens."; J. Comp. Neurol. 410:643-652(1999).
Domain Name	Somatostatin
Hormone Name	[Pro2]-somatostatin-14
Mature Hormone Sequence	APCKNFFWKTFTSC
Position of mature hormone in Pre-Hormone protein	14 Residues from position (96-109)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 5

HMRbase accession number	10761
Swiss-prot Accession number	O73848 (Sequence in FASTA format)
Description	Somatotropin precursor (Growth hormone).
Source organism	Protopterus annectens (African lungfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Dipnoi; Lepidosireniformes; Protopteridae; Protopterus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation
Protein Length	206 Amino acids
Molecular weight	23408
References	1   May D., Alrubaian J., Patel S., Dores R.M., Rand-Weaver M.; "Studies on the GH/SL gene family: cloning of African lungfish(Protopterus annectens) growth hormone and somatolactin and toad (Bufomarinus) growth hormone."; Submitted (MAY-1998) to the EMBL/GenBank/DDBJ databases.
Domain Name	Hormone_1
Hormone Name	Somatotropin
Mature Hormone Sequence	GFPMPSLSSLLSNAVQRANYLHNLAGDRYRDFEQNYISDEQRHSIKNSPAAYCYSESSPAPTGKEDARQKSDMDLLRFSLSLIQAWISPLQILGRPFGSPDAYDKLLDLEKGLQVLMRELEDGSSRGLSLLKHTYDKFSANQFSEEATLKNYSLLACFKKDMHKVETYLRVMKCRRFPESNCTI
Position of mature hormone in Pre-Hormone protein	184 Residues from position (23-206)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated